PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT06992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 341aa    MW: 38260.8 Da    PI: 5.9406
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT06992genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.75.6e-50361682128
       NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...... 95 
                pG+rFhPtdeelv++yL++kv++k+l++ evi+e+diyk++PwdLp +++ ++ekewyfF+ r +ky+++ r+nr+t sg+Wkatg d++++s+      
  EMT06992  36 LPGYRFHPTDEELVTFYLRRKVARKSLRI-EVIREMDIYKHDPWDLPkASTVGGEKEWYFFCLRGRKYRNSIRPNRVTGSGFWKATGIDRPIYSAgsggas 135
               69***************************.99***************445556889**************************************9887776 PP

       NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
               +g  +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  EMT06992 136 SGVSIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 168
               6667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5534193IPR003441NAC domain
PROSITE profilePS5100554.23735194IPR003441NAC domain
PfamPF023651.3E-2437168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MVAKAEMSAM ELEKVMSDGE VVLGGAGDEE EEDVVLPGYR FHPTDEELVT FYLRRKVARK  60
SLRIEVIREM DIYKHDPWDL PKASTVGGEK EWYFFCLRGR KYRNSIRPNR VTGSGFWKAT  120
GIDRPIYSAG SGGASSGVSI GLKKSLVYYR GSAGKGTKTD WMMHEFRLPP AAATNSSPSM  180
QEAEVWTICR IFRRTITYRK QQTWRPVPAP SVADSNSNTG SFESSEAGDE YMNCLQAPAA  240
PCIPQQQYVS QVGTVDSGNF FYEDNMHNQQ FQGQWNAAPA APVPEQKLQS PLSTAVSFHQ  300
NDHSHAVAAN DFYKVEGYLE EIARMMEVTD PTGFYDYRSY G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-483720019171NAC domain-containing protein 19
4dul_A3e-483720019171NAC domain-containing protein 19
1ut7_B3e-483720019171NO APICAL MERISTEM PROTEIN
1ut7_A3e-483720019171NO APICAL MERISTEM PROTEIN
1ut4_B3e-483720019171NO APICAL MERISTEM PROTEIN
1ut4_A3e-483720019171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3604320.0AK360432.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1118B07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981565.11e-161PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK559e-86NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLW5FQ340.0W5FQ34_WHEAT; Uncharacterized protein
TrEMBLM8BVN10.0M8BVN1_AEGTA; NAC domain-containing protein 42
STRINGMLOC_66348.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119138129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.15e-80NAC domain containing protein 42